SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3ctb_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3ctb_A
Domain Number 1 Region: 25-312
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.76e-96
Family Nuclear receptor ligand-binding domain 0.0000000000986
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3ctb_A
Sequence length 344
Comment mol:protein length:344 Pregnane X receptor, Linker, Steroid receptor coactivator 1
Sequence
mkkghhhhhhgsertgtqplgvqglteeqrmmirelmdaqmktfdttfshfknfrlpgvl
ssgcelpeslqapsreeaakwsqvrkdlcslkvslqlrgedgsvwnykppadsggkeifs
llphmadmstymfkgiisfakvisyfrdlpiedqisllkgaafelcqlrfntvfnaetgt
wecgrlsycledtaggfqqlllepmlkfhymlkklqlheeeyvlmqaislfspdrpgvlq
hrvvdqlqeqfaitlksyiecnrpqpahrflflkimamltelrsinaqhtqrllriqdih
pfatplmqelfgitgsggsggsshsslterhkilhrllqegsps
Download sequence
Identical sequences 3ctb_A 3ctb_B 3hvl_A 3hvl_B 6dup_A 6dup_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]