SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3cz2_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3cz2_A
Domain Number 1 Region: 4-118
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 1.25e-28
Family Insect pheromone/odorant-binding proteins 0.00000301
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3cz2_A
Sequence length 119
Comment mol:protein length:119 Pheromone-binding protein ASP1
Sequence
apdwvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvd
deanvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi
Download sequence
Identical sequences 000378183|e3fe8A1|108.2.1.1|A:1-119 cath|current|1r5rA00/3-119 cath|current|2h8vA00/3-119 cath|current|3bfaA00/3-119 cath|current|3bfbA00/3-119 cath|current|3bfhA00/4-119 cath|current|3bjhA00/3-119 cath|current|3cabA00/3-119 cath|current|3cdnA00/4-119 cath|current|3cyzA00/4-119 cath|current|3cyzB00/5-119 cath|current|3cz0A00/2-119 cath|current|3cz0B00/4-119 cath|current|3cz1A00/3-119 cath|current|3cz1B00/5-119 cath|current|3cz2A00/2-119 cath|current|3cz2B00/4-119 cath|current|3fe6A00/3-119 cath|current|3fe8A00/1-119 cath|current|3fe9A00/3-119 d3fe8a_ 1r5rA 2h8v_A 3bfa_A 3bfb_A 3bfh_A 3bjh_A 3cab_A 3cdn_A 3cyz_A 3cyz_B 3cz0_A 3cz0_B 3cz1_A 3cz1_B 3cz2_A 3cz2_B 3fe6_A 3fe8_A 3fe9_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]