SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3d70_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3d70_A
Domain Number 1 Region: 121-276
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 2.44e-52
Family Multidrug-binding domain of transcription activator BmrR 0.0000000533
Further Details:      
 
Domain Number 2 Region: 4-115
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 4.54e-26
Family DNA-binding N-terminal domain of transcription activators 0.00000346
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3d70_A
Sequence length 284
Comment mol:protein length:284 BMR promoter DNA
Sequence
mkesyysigevsklanvsikalryydkidlfkpayvdpdtsyryytdsqlihldlikslk
yigtpleemkkaqdlemeelfafyteqerqirekldflsaleqtislvkkrmkrqmeypa
lgevfvldeeeiriiqteaegigpenvlnasysklkkfiesadgftnnsygatfsfqpyt
sidemtyrhiftpvltnkqissitpdmeittipkgryaciaynfspehyflnlqklikyi
adrqltvvsdvyaliipihyspkkqeeyrvemkirildhhhhhh
Download sequence
Identical sequences 3d70_A 3d70A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]