SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3dll_L from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3dll_L
Domain Number 1 Region: 6-112
Classification Level Classification E-value
Superfamily Translational machinery components 3.22e-43
Family Ribosomal protein L18 and S11 0.00000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3dll_L
Sequence length 114
Comment mol:protein length:114 50S ribosomal protein L18
Sequence
MATATTIRRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALK
SGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGGLDF
Download sequence
Identical sequences Q9RSL2
243230.DR_2112 2zjrL NP_295835.1.55610 WP_010888743.1.45201 WP_010888743.1.61927 WP_010888743.1.86829 gi|15807106|ref|NP_295835.1| 1nkw_M 1sm1_M 2zjp_L 2zjq_L 2zjr_L 3cf5_L 3dll_L 3pio_L 3pip_L 4io9_L 4ioa_L 4ioc_L 4u67_L 4wfn_L 5jvg_L 5jvh_L

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]