SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3mjg_X from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3mjg_X
Domain Number 1 Region: 191-280
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000169
Family I set domains 0.075
Further Details:      
 
Domain Number 2 Region: 3-87
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000428
Family SCOPe 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3mjg_X
Sequence length 289
Comment mol:protein length:289 Beta-type platelet-derived growth factor receptor
Sequence
lvvtppgpelvlnvsstfvltcsgsapvvwermsqeppqemakaqdgtfssvltltnltg
ldtgeyfcthndsrgletderkrlyifvpdptvgflpndaeelfiflteiteitipcrvt
dpqlvvtlhekkgdvalpvpydhqrgfsgifedrsyickttigdrevdsdayyvyrlqvs
sinvsvnavqtvvrqgenitlmcivignevvnfewtyprkesgrlvepvtdflldmpyhi
rsilhipsaeledsgtytcnvtesvndhqdekainitvvesghhhhhhh
Download sequence
Identical sequences 3mjg_X 3mjg_Y

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]