SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3pot_F from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3pot_F
Domain Number 1 Region: 2-249
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.84e-199
Family Methyl-coenzyme M reductase gamma chain 0.00000577
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3pot_F
Sequence length 249
Comment mol:protein length:249 Methyl-coenzyme M reductase I subunit gamma
Sequence
MAQYYPGTTKVAQNRRNFCNPEYELEKLREISDEDVVKILGHRAPGEEYPSVHPPLEEMD
EPEDAIREMVEPIDGAKAGDRVRYIQFTDSMYFAPAQPYVRSRAYLCRYRGADAGTLSGR
QIIETRERDLEKISKELLETEFFDPARSGVRGKSVHGHSLRLDEDGMMFDMLRRQIYNKD
TGRVEMVKNQIGDELDEPVDLGEPLDEETLMEKTTIYRVDGEAYRDDVEAVEIMQRIHVL
RSQGGFNLE
Download sequence
Identical sequences P11562
3pot_C 3pot_F 5a0y_C 5a0y_F 5g0r_C 5g0r_F gi|304315294|ref|YP_003850441.1| WP_013296338.1.93414 cath|current|3potC00/2-247 cath|current|3potF00/2-247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]