SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3s86_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3s86_A
Domain Number 1 Region: 18-196
Classification Level Classification E-value
Superfamily ITPase-like 4.35e-76
Family ITPase (Ham1) 0.000000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3s86_A
Sequence length 208
Comment mol:protein length:208 Nucleoside-triphosphatase
Sequence
mgsdkihhhhhhmkkltvylattnphkveeikmiapewmeilpspekievvedgetflen
svkkavvygkklkhpvmaddsglviyslggfpgvmsarfmeehsykekmrtilkmlegkd
rraafvcsatffdpventlisvedrvegrianeirgtggfgydpffipdgydktfgeiph
lkekishrskafrklfsvlekilesenr
Download sequence
Identical sequences 1vp2A 1vp2_A 1vp2_B 3s86_A 3s86_B 3s86_C 3s86_D cath|current|1vp2A00/3-191 cath|current|1vp2B00/3-191 cath|current|3s86A00/3-191 cath|current|3s86B00/3-191 cath|current|3s86C00/3-191 cath|current|3s86D00/3-191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]