SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3wo4_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3wo4_B
Domain Number 1 Region: 203-296
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000173
Family SCOPe 0.026
Further Details:      
 
Domain Number 2 Region: 2-90
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000393
Family I set domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3wo4_B
Sequence length 312
Comment mol:protein length:312 Interleukin-18 receptor 1
Sequence
GPESCTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIA
LHDCVLEFWPVELNDTGSYFFQMKNYTQKWKLNVIRRNKHSCFTERQVTSKIVEVKKFFQ
ITCENSYYQTLVNSTSLYKNCKKLLLENNKNPTIKKNAEFEDQGYYSCVHFLHHNGKLFN
ITKTFNITIVEDRSNIVPVLLGPKLNHVAVELGKNVRLNCSALLNEEDVIYWMFGEENGS
DPNIHEEKEMRIMTPEGKWHASKVLRIENIGESNLNVLYNCTVASTGGTDTKSFILVRKA
DMADIPGHVFTR
Download sequence
Identical sequences 3wo3_B 3wo3_D 3wo3_F 3wo3_H 3wo3_J 3wo3_L 3wo4_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]