SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4g2k_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4g2k_B
Domain Number 1 Region: 37-122
Classification Level Classification E-value
Superfamily Virus ectodomain 1.98e-21
Family SCOPe 0.00033
Further Details:      
 
Domain Number 2 Region: 17-45
Classification Level Classification E-value
Superfamily Leucine zipper domain 4.1e-18
Family Leucine zipper domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4g2k_B
Sequence length 125
Comment mol:protein length:125 General control protein GCN4, Envelope glycoprotein GP2 chimera
Sequence
mhhhhhhenlyfqgnmkqiedkieeilskiyhieneiarikklignlvsrlrrlanqtak
slelllrvtteertfslinrhaidflltrwggtckvlgpdcsigiedlsrniseqidqik
kdeqk
Download sequence
Identical sequences cath|current|4g2kA00/524-633 cath|current|4g2kB00/524-631 4g2k_A 4g2k_B 4g2k_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]