SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4gip_F from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4gip_F
Domain Number 1 Region: 75-337
Classification Level Classification E-value
Superfamily Head and neck region of the ectodomain of NDV fusion glycoprotein 2.05e-87
Family Head and neck region of the ectodomain of NDV fusion glycoprotein 0.000057
Further Details:      
 
Domain Number 2 Region: 1-106
Classification Level Classification E-value
Superfamily Virus ectodomain 4.19e-35
Family Virus ectodomain 0.0000431
Further Details:      
 
Domain Number 3 Region: 375-402
Classification Level Classification E-value
Superfamily Leucine zipper domain 2.06e-16
Family Leucine zipper domain 0.00068
Further Details:      
 
Domain Number 4 Region: 338-375
Classification Level Classification E-value
Superfamily Virus ectodomain 0.00000000000000134
Family Virus ectodomain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4gip_F
Sequence length 409
Comment mol:protein length:409 Fusion glycoprotein F1
Sequence
fagvviglaalgvataaqvtaavalvkanenaaailnlknaiqktnaavadvvqatqslg
tavqavqdhinsvvspaitaanckaqdaiigsilnlyltelttifhnqitnpalspitiq
alrillgstlptvveksfntqisaaellssglltgqivgldltymqmvikielptltvqp
atqiidlatisafinnqevmaqlptrvmvtgsliqaypasqctitpntvycryndaqvls
ddtmaclqgnltrctfspvvgsfltrfvlfdgivyancrsmlckcmqpaavilqpssspv
tvidmykcvslqldnlrftitqlanvtynstiklessqilsidpldisqnlaavnkslsd
alqhlaqsdtylsaiedkieeilskiyhieneiarikkligeahhhhhh
Download sequence
Identical sequences 4gip_D 4gip_E 4gip_F

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]