SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 4gtm_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4gtm_B
Domain Number 1 Region: 19-419
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.15e-137
Family Protein prenyltransferases 0.000000000000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4gtm_B
Sequence length 427
Comment mol:protein length:427 Protein farnesyltransferase subunit beta
Sequence
massssftyycppssspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfs
sykfnhlvprlvlqrekhfhylkrglrqltdayecldasrpwlcywilhslelldepipq
ivatdvcqflelcqspdggfgggpgqyphlaptyaavnalciigteeaynvinrekllqy
lyslkqpdgsflmhvggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggig
gvpgmeahggytfcglaalvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcy
sfwqagllpllhralhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdf
yhtcyclsglsiaqhfgsgamlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpv
pgfeece
Download sequence
Identical sequences 1o1tB 1o1r_B 1o1s_B 1o1t_B 3eu5_B 4gtm_B 4gto_B 4gtp_B 4gtq_B 4gtr_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]