SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4iqr_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4iqr_B
Domain Number 1 Region: 141-335
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.42e-86
Family Nuclear receptor ligand-binding domain 0.0000000617
Further Details:      
 
Domain Number 2 Region: 20-97
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.24e-53
Family Nuclear receptor 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4iqr_B
Sequence length 338
Comment mol:protein length:338 Hepatocyte nuclear factor 4-alpha
Sequence
mahhhhhhvddddkmgvsalcaicgdratgkhygasscdgckgffrrsvrknhmyscrfs
rqcvvdkdkrnqcrycrlkkcfragmkkeavqnerdristrrssyedsslpsinallqae
vlsrqitspvsgingdirakkiasiadvcesmkeqllvlvewakyipafcelplddqval
lrahagehlllgatkrsmvfkdvlllgndyivprhcpelaemsrvsirildelvlpfqel
qiddneyaylkaiiffdpdakglsdpgkikrlrsqvqvsledyindrqydsrgrfgelll
llptlqsitwqmieqiqfiklfgmakidnllqemllgg
Download sequence
Identical sequences 4iqr_A 4iqr_B 4iqr_E 4iqr_F

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]