SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4iu7_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4iu7_A
Domain Number 1 Region: 13-243
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.57e-89
Family Nuclear receptor ligand-binding domain 0.0000000812
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4iu7_A
Sequence length 247
Comment mol:protein length:247 Estrogen receptor
Sequence
knslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwak
rvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmv
eifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldki
tdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdllle
mldahrl
Download sequence
Identical sequences 001347690|e4mg8B1|188.1.1.8|B:6-252 001840014|e4zwhA1|188.1.1.8|A:1-247 001840016|e4zwkA1|188.1.1.8|A:1-247 001918893|e5kceA1|188.1.1.8|A:6-252 001918895|e5kcfA1|188.1.1.8|A:6-252 cath|current|4iu7A00/304-548 cath|current|4iu7B00/305-549 cath|current|4iuiA00/305-548 cath|current|4iuiB00/308-549 cath|current|4iv2A00/305-548 cath|current|4iv2B00/305-548 cath|current|4iv4A00/305-548 cath|current|4iv4B00/305-548 cath|current|4ivwA00/303-548 cath|current|4ivwB00/304-548 cath|current|4ivyA00/304-548 cath|current|4ivyB00/305-548 cath|current|4iw6A00/304-548 cath|current|4iw6B00/305-548 cath|current|4iw8A00/305-548 cath|current|4iw8B00/304-548 cath|current|4iwcA00/305-548 cath|current|4iwcB00/305-549 cath|current|4iwfA00/305-548 cath|current|4iwfB00/306-548 4iu7_A 4iu7_B 4iui_A 4iui_B 4iv2_A 4iv2_B 4iv4_A 4iv4_B 4ivw_A 4ivw_B 4ivy_A 4ivy_B 4iw6_A 4iw6_B 4iw8_A 4iw8_B 4iwc_A 4iwc_B 4iwf_A 4iwf_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]