SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4j5x_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4j5x_B
Domain Number 1 Region: 17-304
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.61e-96
Family Nuclear receptor ligand-binding domain 0.0000000000986
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4j5x_B
Sequence length 336
Comment mol:protein length:336 Nuclear receptor subfamily 1 group I member 2, Nuclear receptor coactivator 1
Sequence
snasertgtqplgvqglteeqrmmirelmdaqmktfdttfshfknfrlpgvlssgcelpe
slqapsreeaakwsqvrkdlcslkvslqlrgedgsvwnykppadsggkeifsllphmadm
stymfkgiisfakvisyfrdlpiedqisllkgaafelcqlrfntvfnaetgtwecgrlsy
cledtaggfqqlllepmlkfhymlkklqlheeeyvlmqaislfspdrpgvlqhrvvdqlq
eqfaitlksyiecnrpqpahrflflkimamltelrsinaqhtqrllriqdihpfatplmq
elfgitgsggsggsshsslterhkilhrllqegsps
Download sequence
Identical sequences cath|current|4j5wA00/141-461 cath|current|4j5wB00/141-461 cath|current|4j5xA00/141-458 cath|current|4j5xB00/139-460 4j5w_A 4j5w_B 4j5x_A 4j5x_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]