SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4k3e_H from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4k3e_H
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily Immunoglobulin 1.63e-37
Family V set domains (antibody variable domain-like) 0.00016
Further Details:      
 
Domain Number 2 Region: 169-267
Classification Level Classification E-value
Superfamily Immunoglobulin 1.21e-24
Family C1 set domains (antibody constant domain-like) 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4k3e_H
Sequence length 275
Comment mol:protein length:275 BOVINE ANTIBODY WITH ULTRALONG CDR H3, HEAVY CHAIN
Sequence
evqlresgpslvqpsqtlsltctasgfslsdkavgwvrqapgkalewlgsidtggstgyn
pglksrlsitkdnsksqvslsvssvttedsatyycttvhqetrktcsdgyiavdscgrgq
sdgcvndcnscyygwrncrrqpaihsyefhvdawgrgllvtvssasttapkvyplssccg
dkssstvtlgclvssympepvtvtwnsgalksgvhtfpavlqssglyslssmvtvpgsts
gqtftcnvahpasstkvdkavepkscdgshhhhhh
Download sequence
Identical sequences 4k3e_H 4k3e_I

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]