SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4n21_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4n21_C
Domain Number 1 Region: 51-126
Classification Level Classification E-value
Superfamily Virus ectodomain 2.42e-20
Family SCOPe 0.0000735
Further Details:      
 
Domain Number 2 Region: 17-45
Classification Level Classification E-value
Superfamily Leucine zipper domain 4.34e-18
Family Leucine zipper domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4n21_C
Sequence length 130
Comment mol:protein length:130 GP2 Ectodomain
Sequence
mhhhhhhenlyfqgnmkqiedkieeilskiyhieneiarikkligaiaskiiktanyttn
alfllnkeeseirdhvvehelalnyllahqgglcnvvkgpmcssdiddfsknvsdmidkv
heemkkfyhe
Download sequence
Identical sequences 4n21_A 4n21_B 4n21_C 4n21_D 4n21_E 4n21_F 4n23_A 4n23_B 4n23_C cath|current|4n21A00/229-351 cath|current|4n23C00/228-351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]