SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4nqa_I from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4nqa_I
Domain Number 1 Region: 148-387
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.08e-91
Family Nuclear receptor ligand-binding domain 0.00000000445
Further Details:      
 
Domain Number 2 Region: 16-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.82e-41
Family Nuclear receptor 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4nqa_I
Sequence length 391
Comment mol:protein length:391 Liver X nuclear receptor beta
Sequence
mkrkkgpapkmlghelcrvcgdkasgfhynvlscegckgffrrsvvrggarryacrgggt
cqmdafmrrkcqqcrlrkckeagmreqcvlseeqirkkkirkqqqqesqsqsqspvgpqg
ssssasgpgaspggseagsqgsgegegvqltaaqelmiqqlvaaqlqcnkrsfsdqpkvt
pwplgadpqsrdarqqrfahftelaiisvqeivdfakqvpgflqlgredqiallkastie
imlletarrynhetecitflkdftyskddfhraglqvefinpifefsramrrlglddaey
alliainifsadrpnvqepgrvealqqpyveallsytrikrpqdqlrfprmlmklvslrt
lssvhseqvfalrlqdkklppllseiwdvhe
Download sequence
Identical sequences 4nqa_B 4nqa_I

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]