SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4qpl_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4qpl_A
Domain Number 1 Region: 47-153
Classification Level Classification E-value
Superfamily WWE domain 5.86e-34
Family WWE domain 0.00000111
Further Details:      
 
Domain Number 2 Region: 7-52
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000661
Family RING finger domain, C3HC4 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4qpl_A
Sequence length 155
Comment mol:protein length:155 E3 ubiquitin-protein ligase RNF146
Sequence
GSLTVPECAICLQTCVHPVSLPCKHVFCYLCVKGASWLGKRCALCRQEIPEDFLDKPTLL
SPEELKAASRGNGEYAWYYEGRNGWWQYDERTSRELEDAFSKGKKNTEMLIAGFLYVADL
ENMVQYRRNEHGRRRKIKRDIIDIPKKGVAGLRLD
Download sequence
Identical sequences 4qpl_A 4qpl_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]