SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4r6u_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4r6u_A
Domain Number 1 Region: 202-295
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000176
Family SCOPe 0.026
Further Details:      
 
Domain Number 2 Region: 7-89
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000975
Family I set domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4r6u_A
Sequence length 317
Comment mol:protein length:317 Interleukin-18 receptor 1
Sequence
AESCTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIAL
HDCVLEFWPVELNDTGSYFFQMKNYTQKWKLNVIRRNKHSCFTERQVTSKIVEVKKFFQI
TCENSYYQTLVNSTSLYKNCKKLLLENNKNPTIKKNAEFEDQGYYSCVHFLHHNGKLFNI
TKTFNITIVEDRSNIVPVLLGPKLNHVAVELGKNVRLNCSALLNEEDVIYWMFGEENGSD
PNIHEEKEMRIMTPEGKWHASKVLRIENIGESNLNVLYNCTVASTGGTDTKSFILVRKAD
MADIPGHVFTRHHHHHH
Download sequence
Identical sequences 4r6u_A 4r6u_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]