SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4uw5_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4uw5_A
Domain Number 1 Region: 4-135
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.24e-62
Family Galectin (animal S-lectin) 0.00000767
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4uw5_A
Sequence length 136
Comment mol:protein length:136 HUMAN GALECTIN-7
Sequence
MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEV
VFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVR
LVEVGGDVQLDSVRIF
Download sequence
Identical sequences A0A2J8QF73 G3R188 P47929
4uw3_A 4uw3_B 4uw4_A 4uw4_B 4uw5_A 4uw5_B 4uw5_C 4uw5_D 4uw5_E 4uw5_F 4uw6_A 4uw6_B gi|109948279|ref|NP_001035972.1| gi|4504985|ref|NP_002298.1| 001844309|e5h9qA1|10.1.1.171|A:20-155 cath|current|4uw3A00/2-135 cath|current|4uw3B00/4-135 cath|current|4uw4A00/3-135 cath|current|4uw4B00/3-135 cath|current|4uw5A00/4-135 cath|current|4uw5B00/3-135 cath|current|4uw5C00/4-135 cath|current|4uw5D00/4-135 cath|current|4uw5E00/3-135 cath|current|4uw5F00/4-135 cath|current|4uw6A00/4-135 cath|current|4uw6B00/5-135 d3zxfb1 d5h9qa_ NP_001035972.1.87134 NP_001035972.1.92137 NP_002298.1.87134 NP_002298.1.92137 XP_004060726.1.27298 XP_018870466.1.27298 9606.ENSP00000313571 9606.ENSP00000367891 ENSGGOP00000008934 ENSGGOP00000008942 ENSGGOP00000017907 ENSGGOP00000026178 ENSP00000313571 ENSP00000367891 ENSP00000313571 ENSP00000367891 ENSP00000313571 ENSP00000367891 ENSGGOP00000008942 NYSGRC-LECT-ENSP00000367891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]