SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4v61_AK from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4v61_AK
Domain Number 1 Region: 25-140
Classification Level Classification E-value
Superfamily Translational machinery components 3.91e-45
Family Ribosomal protein L18 and S11 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4v61_AK
Sequence length 140
Comment mol:protein length:140 Ribosomal Protein S11
Sequence
makpipkigsrrngrissrksasarkipkgvihvqasfnntivtvtdvrgrvvswasagt
cgfrgtkrgtpfaaqtaagnairtvveqgmqraevmikgpglgrdaalrairrsgillsf
vrdvtpmphngcrppkkrrv
Download sequence
Identical sequences 3bbnK 4v61_AK

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]