SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5iku_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5iku_A
Domain Number 1 Region: 126-239
Classification Level Classification E-value
Superfamily Collagen-binding domain 4.03e-36
Family Collagen-binding domain 0.000000413
Further Details:      
 
Domain Number 2 Region: 11-120
Classification Level Classification E-value
Superfamily Collagen-binding domain 6.59e-21
Family Collagen-binding domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5iku_A
Sequence length 240
Comment mol:protein length:240 Collagenase
Sequence
GIPGTTTPITKEMEPNDDIKEANGPIVEGVTVKGDLNGSDDADTFYFDVKEDGDVTIELP
YSGSSNFTWLVYKEGDDQNHIASGIDKNNSKVGTFKSTKGRHYVFIYKHDSASNISYSLN
IKGLGNEKLKEKENNDSSDKATVIPNFNTTMQGSLLGDDSRDYYSFEVKEEGEVNIELDK
KDEFGVTWTLHPESNINDRITYGQVDGNKVSNKVKLRPGKYYLLVYKYSGSGNYELRVNK
Download sequence
Identical sequences 5iku_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]