SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5ilt_H from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5ilt_H
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily Immunoglobulin 2.02e-35
Family V set domains (antibody variable domain-like) 0.00011
Further Details:      
 
Domain Number 2 Region: 174-269
Classification Level Classification E-value
Superfamily Immunoglobulin 2.64e-24
Family C1 set domains (antibody constant domain-like) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5ilt_H
Sequence length 271
Comment mol:protein length:271 bovine Fab A01 heavy chain
Sequence
QVQLRESGPSLVKPSQTLSLTCTASGFSLSDKAVGWVRQAPEKALEWLGSIDTSGTTGYN
SGLKSRLSIIKDNSKSQVSLSVSSVTTEDSATYYCTIVHQETSRRGPDGYSWICECSSGT
YTCDADNCGNLCPSDWQLTLHCHRLDSSTYTYDWHVETWGQGLRVTVSSASTTAPKVYPL
SSCCGDKSSSTVTLGCLVSSYMPEPVTVTWNSGALKSGVHTFPAVLQSSGLYSLSSMVTV
PGSTSGQTFTCNVAHPASSTKVDKAVEPKSC
Download sequence
Identical sequences 5ilt_H

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]