SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5jvg_U from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5jvg_U
Domain Number 1 Region: 1-74
Classification Level Classification E-value
Superfamily L28p-like 3.95e-17
Family Ribosomal protein L28 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5jvg_U
Sequence length 81
Comment mol:protein length:81 50S ribosomal protein L28
Sequence
MSRECYLTGKKNLVVNSVIRRGKARADGGVGRKTTGITKRVQRANLHKKAIRENGQVKTV
WLSANALRTLSKGPYKGIELI
Download sequence
Identical sequences Q9RRG8
2zjp_U 2zjq_U 2zjr_U 3cf5_U 3dll_U 3pio_U 3pip_U 4io9_U 4ioa_U 4ioc_U 4u67_U 4wfn_U 5jvg_U 5jvh_U 2zjrU 243230.DR_2524 gi|15807508|ref|NP_296244.1| NP_296244.1.55610 WP_010889149.1.45201 WP_010889149.1.61927 WP_010889149.1.86829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]