SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5k2o_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5k2o_A
Domain Number 1 Region: 14-176
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.58e-98
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000000369
Further Details:      
 
Domain Number 2 Region: 377-558
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.86e-97
Family Pyruvate oxidase and decarboxylase PP module 0.00000000938
Further Details:      
 
Domain Number 3 Region: 196-343
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 9.62e-86
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5k2o_A
Sequence length 590
Comment mol:protein length:590 Acetolactate synthase, chloroplastic
Sequence
tfisrfapdqprkgadilvealerqgvetvfaypggasmeihqaltrsssirnvlprheq
ggvfaaegyarssgkpgiciatsgpgatnlvsgladalldsvplvaitgqvprrmigtda
fqetpivevtrsitkhnylvmdvedipriieeafflatsgrpgpvlvdvpkdiqqqlaip
nweqamrlpgymsrmpkppedshleqivrliseskkpvlyvgggclnssdelgrfveltg
ipvastlmglgsypcddelslhmlgmhgtvyanyavehsdlllafgvrfddrvtgkleaf
asrakivhididsaeigknktphvsvcgdvklalqgmnkvlenraeelkldfgvwrneln
vqkqkfplsfktfgeaippqyaikvldeltdgkaiistgvgqhqmwaaqfynykkprqwl
ssgglgamgfglpaaigasvanpdaivvdidgdgsfimnvqelatirvenlpvkvlllnn
qhlgmvmqwedrfykanrahtflgdpaqedeifpnmllfaaacgipaarvtkkadlreai
qtmldtpgpylldvicphqehvlpmipsggtfndvitegdgrlehhhhhh
Download sequence
Identical sequences 1ybhA 1ybh_A 1yhy_A 1yhz_A 1yi0_A 1yi1_A 1z8n_A 5k2o_A 5k3s_A 5k6q_A 5k6r_A 5k6t_A 5wj1_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]