SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5uan_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5uan_B
Domain Number 1 Region: 118-356
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.5e-104
Family Nuclear receptor ligand-binding domain 0.00000000987
Further Details:      
 
Domain Number 2 Region: 30-104
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.3e-55
Family Nuclear receptor 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5uan_B
Sequence length 397
Comment mol:protein length:397 Retinoic acid receptor beta
Sequence
MGSSHHHHHHSSGLVPRGSHMPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQK
NMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESY
EMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIK
IVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMH
NAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEA
LKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSE
GHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
Download sequence
Identical sequences 5uan_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]