SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5zwn_T from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5zwn_T
Domain Number 1 Region: 20-486
Classification Level Classification E-value
Superfamily TPR-like 5.41e-18
Family HAT/Suf repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5zwn_T
Sequence length 544
Comment mol:protein length:544 U1 small nuclear ribonucleoprotein component PRP42
Sequence
MDKYTALIHDENFSTLTLNVSRYPKSLAYWEKLLNYIVKASAPICKSTEPQLLKLIRCTY
SSMLNEFPYLENYYIDFALLEYKLGNVSMSHKIFQRGLQAFNQRSLLLWTSYLKFCNNVI
SHQKQLFKKYETAEEYVGLHFFSGEFWDLYLEQISSRCTSSKKYWNVLRKILEIPLHSFS
KFYALWLQRIDDIMDLKQLSQLTSKDELLKKLKIDINYSGRKGPYLQDAKKKLKKITKEM
YMVVQYQVLEIYSIFESKIYINYYTSPETLVSSDEIETWIKYLDYTITLQTDSLTHLNFQ
RALLPLAHYDLVWIKYSKWLINSKNDLLGAKNVLLMGLKFSLKKTEIIKLLYSVICKLNE
YVLLRNLLEKIESSYSDNVENVDDFEIFWDYLQFKTFCQNSLYSSRYSDSQSNGLLNKEL
FDKVWKRLSCKEKKSGQEILLNNLVQFYSKDTVEFVEKNIFQKIIEFGWEYYLQNGMFWN
CYCRLIYFDTSRSYLDKRQYIVRKIWPQIDKKFAQSVLPSLTEFCESYFPEEMDTLEEMF
TEEP
Download sequence
Identical sequences N1P6X1 Q03776
YDR235W YDR235W NP_010521.1.97178 354923 4932.YDR235W YDR235W YDR235W 5uz5_D 5zwn_T 6g90_E

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]