SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5zwn_U from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5zwn_U
Domain Number 1 Region: 77-484
Classification Level Classification E-value
Superfamily TPR-like 4.85e-26
Family HAT/Suf repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5zwn_U
Sequence length 629
Comment mol:protein length:629 Pre-mRNA-processing factor 39
Sequence
MPDETNFTIEDIEPRPDALRGLDTQFLQDNTALVQAYRGLDWSDISSLTQMVDVIEQTVV
KYGNPNDSIKLALETILWQILRKYPLLFGFWKRFATIEYQLFGLKKSIAVLATSVKWFPT
SLELWCDYLNVLCVNNPNETDFIRNNFEIAKDLIGKQFLSHPFWDKFIEFEVGQKNWHNV
QRIYEYIIEVPLHQYARFFTSYKKFLNEKNLKTTRNIDIVLRKTQTTVNEIWQFESKIKQ
PFFNLGQVLNDDLENWSRYLKFVTDPSKSLDKEFVMSVFDRCLIPCLYHENTWMMYIKWL
TKKNISDEVVVDIYQKANTFLPLDFKTLRYDFLRFLKRKYRSNNTLFNNIFNETVSRYLK
IWPNDILLMTEYLCMLKRHSFKNSLDQSPKEILEKQTSFTKILETSITNYINNQIDAKVH
LQTLINDKNLSIVVVELIKTTWLVLKNNMQTRKYFNLYQKNILIKNSVPFWLTYYKFEKS
NVNFTKLNKFIRELGVEIYLPTTVMNDILTDYKTFYLTHSNIVTYESSIIDSNTFDPILY
PELKMSNPKYDPVLNTTANVDWHKKTEWKEAGHIGITTERPQISNSIIECNSGTLIQKPI
SLPNFRNLEKINQVKINDLYTEEFLKEGK
Download sequence
Identical sequences A0A250WF56 G2WK11 N1P698 P39682
YML046W YML046W NP_013667.1.97178 YML046W 4932.YML046W YML046W YML046W YML046W 5uz5_E 5zwn_U 6g90_D YML046W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]