SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9ant_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9ant_A
Domain Number 1 Region: 3-60
Classification Level Classification E-value
Superfamily Homeodomain-like 1.55e-37
Family Homeodomain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9ant_A
Sequence length 62
Comment mol:protein length:62 ANTENNAPEDIA HOMEODOMAIN
Sequence
merkrgrqtytryqtlelekefhfnryltrrrrieiahalslterqikiwfqnrrmkwkk
en
Download sequence
Identical sequences cath|current|9antA00/5-60 cath|current|9antB00/5-60 9ant_A 9ant_B 9antA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]