SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MAL7P1.159 from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MAL7P1.159
Domain Number 1 Region: 62-237
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.55e-32
Family Glutathione peroxidase-like 0.000000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MAL7P1.159
Sequence length 240
Comment AOP 1-cys peroxiredoxin 7919163:7920029 forward MW:28124
Sequence
MRMRRTILIFTVILIPLTFCFKNALIKHSINIVSKRGNSKNRFSQKVYESKNIDLENDIK
ENDLIPNVKVMIDVRNMNNISDTDGSPNDFTSIDTHELFNNKKILLISLPGAFTPTCSTK
MIPGYEEEYDYFIKENNFDDIYCITNNDIYVLKSWFKSMDIKKIKYISDGNSSFTESMNM
LVDKSNFFMGMRPWRFVAIVENNILVKMFQEKDKQHNIQTDPYDISTVNNVKEFLKNNQL
Download sequence
Identical sequences A0A024V8F8 A0A024VSZ6 A0A024WA22 A0A024WSV8 A0A024X9Y1 A0A0L1IBX9 Q5MYR6 W7FF87 W7JX88
gi|225632188|emb|CAX64072.1| gi|296004905|ref|XP_002808799.1| gi|34591895|gb|AAQ76285.1| 5833.MAL7P1.159-1 XP_002808799.1.26446 MAL7P1.159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]