SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PF10_0340 from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PF10_0340
Domain Number 1 Region: 222-565
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.95e-99
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000797
Further Details:      
 
Domain Number 2 Region: 567-720
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.12e-27
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.003
Further Details:      
 
Domain Number 3 Region: 70-191
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000112
Family Glutathione S-transferase (GST), C-terminal domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PF10_0340
Sequence length 889
Comment PF10_0340 methionine-tRNA ligase, putative 12462839:12465508 forward MW:104169
Sequence
MMKPLNMILYPHKFFLNTVKCMLAAHIYNFNVELSEDFLYTRTFDIEKSLIINKKPLLIY
ENNYVSSTKAICFLFHRLRNKSKKPFDENLSYYLGWLEWSDLLEKHIEVLNKKNIIESLD
ELELYLKENKNKNKNFINNDDEKDENKLSLADIFVYTSLKHSCIEICKESWVHINEYIEK
INNLQEIQNVIKNVEEIYKYKNIYSVFISKIHDKNVNEYLKNETFYITTAINYVNGDPHI
GHAYEIVLADAIARYHKIIGRDTFFTTGADEHGLKIANQAAKNNMTPKELCDKNVLKFQN
LNKLLYVEDDYYVRTTRDSHKKIAQEVWDKCEKNGDIYLGEYEGWYNVREETYVPENEAK
LMNYIDPLNNIKLEKMKEPSYFFKMSKYQDKLIEYIQSNPDYIQPEQKRNEILQRLKEPL
ADLSCSRTKFTWGIQVPNDPKHVMYVWMDALINYYSSCFIDEGKKKYWPANVHIIGKDIT
WFHTVIFPTILLSANIPLSKSVFSHGFVLAADGKKMSKSLGNVINPLEIIDKYGADAFRY
HVIKETKRGCDTRFDVDNLVDMCNSDLADTIGNLVQRTLSLCQLCNESKIPAFYPEYEIH
LPIDILHFINRVEYHMKTFCVQKCCEKSVQVCKDLNKFLTDMAPWKYKDDLKNKKLHIIR
IMLEAIYFIAHYLDIFIPSLSHKIFEKLNTPKKVIADLSPWLNNLTEGVIINNDNILFKK
YEVETAKIKLQKVIIRVCKIVNIINTESSQNTTICEIEVDNDKITAVLYLPYNNNNNKLV
NLLTLAILNIKPLTINNITVNAIIPHVRKEIFTFPIEERIPTGTLIQGKNYKTLVKQRDN
LTKKEVVSLDLSIINNKCFFEKNIPLVFASHEDKQVYHSTQDNGSLTFF
Download sequence
Identical sequences Q8IJ60 W7K331
PF10_0340 XP_001347624.1.26446 gi|124802884|ref|XP_001347624.1| gi|23495207|gb|AAN35537.1| 5833.PF10_0340-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]