SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PF10_0359 from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PF10_0359
Domain Number 1 Region: 27-198
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.41e-33
Family Phosducin 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PF10_0359
Sequence length 209
Comment PF10_0359 conserved Plasmodium protein, unknown function 12525307:12526886 reverse MW:24598
Sequence
MIPKNKLSDICTTLTLEKAKEDIEKECKLVEKKKQKHDDEKDEGLIVDGNEENNVGENSD
EEEIRKWREKRLMEFKKKRELKRDGVYTEVCEKDFLPCVLKNNNVCHFYDNSFKRCDILH
SHLIKLANKHLATKFIKMEAKNCLFFMNKLNIKVLPSLCLFIDGVLIQTCVGFEDFGNND
NFKTKDLEMFLYKKKIINNMECSDSDEDI
Download sequence
Identical sequences Q8IJ41
XP_001347643.2.26446 PF10_0359 gi|254922491|gb|AAN35556.2| gi|258597157|ref|XP_001347643.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]