SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PF11_0286 from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PF11_0286
Domain Number 1 Region: 28-139
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.34e-18
Family PDI-like 0.024
Further Details:      
 
Domain Number 2 Region: 234-344
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000239
Family PDI-like 0.072
Further Details:      
 
Weak hits

Sequence:  PF11_0286
Domain Number - Region: 165-245
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0035
Family PDI-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PF11_0286
Sequence length 424
Comment PF11_0286 protein disulfide isomerase, putative 13834242:13837264 forward MW:51186
Sequence
MIIKFLIFNLLLYLFRCNTKVNFTYPQNDFLRIDSENIEEAFENNDYWLINFYAPQCVYC
KFIWDKLRYIQRSIQNENRTKIYFGEVNCDNQKGYTVCEIYGAMRVPQLKLFKGSELIST
YSNDITNYNNIKSWIYYITTPLFVGVQDENELKSYETENNIFLTCSENLPADLFDVAKLY
KEECYFINITNPDMCTRMNIKTNELHVMSAYNHSTYDLDTLDRELLKLFVNKNRFPLVMK
IDHRNFFNIRSSGNNLMLLLLDMKKNPNAYILEYKQYAEKYKNHNDILFGYIDGKYYEEN
LELYGTDSDYYPQIIVFSKNPREYYFEGYFNIDNVDNIIYDVKNKRIYHKFEEFTKFRII
LIKFKKHIKYILKKAFKTDFLSFIGFICSVIMMLLTAILVIHTIYKYYMSYTHNTYIEKE
EKSE
Download sequence
Identical sequences A0A024UXU8 A0A0L7KAZ0 A0A2I0C119 Q8II88 W4IFZ8
PFHG_01894T0 gi|124804286|ref|XP_001347957.1| gi|23496211|gb|AAN35870.1| 5833.PF11_0286-1 XP_001347957.1.26446 PF11_0286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]