SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PF11_0352 from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PF11_0352
Domain Number 1 Region: 111-277
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.81e-30
Family PDI-like 0.0075
Further Details:      
 
Domain Number 2 Region: 23-138
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000505
Family PDI-like 0.058
Further Details:      
 
Domain Number 3 Region: 282-394
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000673
Family Txnl5-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PF11_0352
Sequence length 423
Comment PfPDI-11 protein disulfide isomerase 14090088:14091359 reverse MW:49195
Sequence
MKVYNFSFICISLIFVFIKRSLGLYTNVAEIETVDNPKRLEELLNLKKVYLVQFYATWCR
VSRGFSNDFINIAKTLKDDVKFIAIKNESILNEYKITEYPTMHLIFGNEHNNKKEVEKFD
GKYKIKDVVSFIYEGIKNYRLKELNIDTSKKSSYKKKSKGKNDGKVIILNDSNFDQNVIQ
YDDNVWFVFFYAPWCGHSKPIHPMFDELAKKVAHLKNAKIAKIDATVEQRTAQTYQINHY
PSFRLFPSGNKKPHTAIDYNDSRTVDDLYHFFLKYYVEKKELIQLTSQQVFDEFCEKDVC
LLALLPNKEDTEPSYFKSYVHILSNVIKDVNHLPVTLLWTQAGDQLDIVQKLNLTFGFPT
VIALSLSKNVFSILKGNYSEQSIKNFITQMMMGKSSVDNLVPFKVKNVPKFSFNASNDIN
TEL
Download sequence
Identical sequences A0A024VJN4 A0A024WPF3 A0A024X692 A0A0L0CXU1 A0A0L1IE68 A0A0L7KDX6 A0A0L7LZL5 Q8II23 W4ISP6 W7FKC3 W7G371 W7J9U7 W7K357
PF11_0352 5833.PF11_0352-1 PFDG_01602T0 PFHG_03031T0 XP_001348023.1.26446 gi|124804507|ref|XP_001348023.1| gi|23496278|gb|AAN35936.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]