SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PF13_0011 from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PF13_0011
Domain Number 1 Region: 21-206
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 4.71e-98
Family Gametocyte protein Pfg27 0.00000000566
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PF13_0011
Sequence length 217
Comment Pfg27 gamete antigen 27/25 17198702:17199355 reverse MW:26004
Sequence
MSKVQKDSAKPLDKFGNIYDYHYEHETHAPLSPRIRKVGDIEFHACSDYIYLLMTLSKDP
EKFNYALKDRVSIRRYVRKNQNRYNYFLIEERVQDNIVNRISDRLISYCTDKEVTEDYIK
KIDDYLWVEQRVIEEVSINVDHAREVKEKKRIMNDKKLIRMLFDTYEYVKDVKFTDDQYK
DAAARISQFLIDVVDSYIIKPIPALPVTPDEPHHNNI
Download sequence
Identical sequences A0A024V1Z4 A0A024VNV3 A0A024VXX7 A0A024WMU9 A0A024X3V2 Q27336 Q8IEU2 W4IZR1 W7FKF8 W7JPQ5 W7JTX5
XP_001349749.1.26446 gi|124512786|ref|XP_001349749.1| gi|23615166|emb|CAD52156.1| PF13_0011 5833.PF13_0011-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]