SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PF14_0368 from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PF14_0368
Domain Number 1 Region: 2-194
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.78e-59
Family Glutathione peroxidase-like 0.0000000844
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PF14_0368
Sequence length 195
Comment TPx1 thioredoxin peroxidase 1 21548394:21548981 forward MW:21807
Sequence
MASYVGREAPYFKAEAVFADNTFGEVNLHDFIGKKYVLLYFYPLDFTFVCPSEIIALDKA
LDAFKERNVELIGCSVDSKYTHLAWKKTPLTKGGIGNIQHTLISDITKSISRSYNVLFGD
SVSLRAFVLIDKQGVVQHLLVNNLAIGRSVEEVLRIIDAVQHHEQHGDVCPANWKKGKVA
MKPSEEGVSEYLSKL
Download sequence
Identical sequences A0A024V058 A0A024VZ28 A0A024WGD8 A0A024WZM5 A0A0L7K644 A0A0L7M1G7 Q8IL80 Q9N699 W4IA13 W4IXF8 W7F7C6 W7FPU2 W7JQN9 W7K747
XP_001348542.1.26446 PFDG_02440T0 5833.PF14_0368-1 PFHG_00298T0 gi|124809308|ref|XP_001348542.1| gi|23497438|gb|AAN36981.1| PF14_0368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]