SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PF14_0488 from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PF14_0488
Domain Number 1 Region: 130-195
Classification Level Classification E-value
Superfamily RING/U-box 0.00000918
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PF14_0488
Sequence length 229
Comment PF14_0488 conserved Plasmodium protein, unknown function 22077350:22079450 forward MW:27608
Sequence
MSRRKKEISDETEKHAEDETVDEIPYFKEIWNKLDQYEEEYLPSNEIQKYHCNLQKSLFN
ILFSIKYFNEINIDSQYLKLVNKFVKLKLQGNQSDEKDISRLARFYLKNEKENDEDELLL
DEELGVFPTKCPISQMPFENPVTQRFSKNRKACVHTFEKAFILRLMHNKDTIECPIAACK
KKVYKSSLHPDYEFLHHSRYKKFRDHITDALEYFNNIRNEEKEILDFAE
Download sequence
Identical sequences A0A2I0C2T7 Q8IKW3
XP_001348662.2.26446 gi|255528878|gb|AAN37101.2| gi|258597839|ref|XP_001348662.2| PF14_0488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]