SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFC0166w from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFC0166w
Domain Number 1 Region: 31-157
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.13e-19
Family Glutathione peroxidase-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PFC0166w
Sequence length 179
Comment Plrx plasmoredoxin 1777250:1777789 forward MW:21698
Sequence
MACQVDNPPKTYPNDKTAEYEKYANYMNYLYYYQNNELKKIDSSYFKDKYLGLFFGASWC
KYCVTFIDSLNIFKKNFPNVEIIYIPFDRTYQEYQSFLKNTNFYALPFDNYLYICKKYQI
KNLPSFMLITPNNNILVKDAAQLIKTDEYINNLKSLIKNYIIHPKTFQFNNRFFDLFRN
Download sequence
Identical sequences A0A024VDI7 A0A024VW52 A0A024WDG6 A0A024WXZ8 A0A024XEL9 Q8I224 Q9NC62 W4INX9 W4ISH3 W7FJQ0 W7K1K9 W7K4D5
XP_001351111.1.26446 gi|124504737|ref|XP_001351111.1| gi|23477023|emb|CAD49085.1| 5833.PFC0166w-1 PFC0166w

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]