SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFE0900w from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFE0900w
Domain Number 1 Region: 39-71
Classification Level Classification E-value
Superfamily RING/U-box 0.000000016
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Weak hits

Sequence:  PFE0900w
Domain Number - Region: 147-180
Classification Level Classification E-value
Superfamily RING/U-box 0.0682
Family U-box 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PFE0900w
Sequence length 270
Comment PFE0900w conserved protein, unknown function 4605252:4607026 forward MW:31471
Sequence
MARHSKNNTANPIFTYHERKKVKDVGTLRERLGKDSMRKFEQCWICLRTAENPVSSPYGH
IFCKICIINNFLNQKKIYARKKKEYEDYIKDLKKKKKEELLQEKEKEKKKFVQDLENLNT
VNVQKEEEKNLLDISNNFWLSCNTSKVKKDTIQKKLKPPSKNLICPITKKPLKMNELITI
NPEVIKNGDSENGGWVCSFSKKNIDHHKAVLLKKTGKIILKSFFENFIYGKKNSYDITVG
EDDFINLEAGGTAFCSHSNVEKTLYRESLL
Download sequence
Identical sequences A0A024UXC9 A0A024VW24 A0A2I0BUE8 C0H4E6 W4ILR5 W7FS75 W7FUI7
PFE0900w XP_002808697.1.26446 gi|225631684|emb|CAX63968.1| gi|296004556|ref|XP_002808697.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]