SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFE1490c from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFE1490c
Domain Number 1 Region: 219-282
Classification Level Classification E-value
Superfamily RING/U-box 2.59e-16
Family RING finger domain, C3HC4 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PFE1490c
Sequence length 284
Comment PFE1490c RING zinc finger protein, putative 5075363:5076578 reverse MW:34146
Sequence
MVEEENGLRSYFRRLYINTSDYVKNYMTASDQEMQNNADPIMDIIATAPSDSLYFIERIN
LISAIISLSTSFPYLTYLLIYWKDCSCNDILRWWIVINSILQLIQAPVRFFLYFLLRKYK
SENERMHIHALRRLTSSKGWKLSKRFSLLNYLWFITGTVVMVVTRKHTKNFYLWFISWTI
ILSCIFRVFFTIIWFCFFFPYHQNIPKKKKGVPKTFFSEITTFKYTLTRKLKNESCSICL
SDFVEKDEIMELNCLHNFHTKCAKKWLSQKRHCPLCQRDVMKPI
Download sequence
Identical sequences A0A024VA55 A0A024WZ66 A0A0L1IDG4 A0A0L7KE77 A0A2I0BUI5 Q8I3G9 W4ILM6 W7FSI0 W7GB92
gi|124506509|ref|XP_001351852.1| gi|23504878|emb|CAD51659.1| PFE1490c 5833.PFE1490c-1 PFHG_02899T0 XP_001351852.1.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]