SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFI0805w from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PFI0805w
Domain Number - Region: 2468-2509
Classification Level Classification E-value
Superfamily RING/U-box 0.000965
Family RING finger domain, C3HC4 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PFI0805w
Sequence length 2519
Comment PFI0805w conserved Plasmodium protein, unknown function 10221222:10228781 forward MW:305339
Sequence
MTKIQNDIMLPFFSVSSKHCKNNTNVVTYCRTRKRRKRKRKKEKYCHRCINIRKLIKYEK
YNNLKSNYVYIDLKKMIRNKSYENDYKYFVKYNNIKSSNIINSNNIKNYKKKYLESLPFY
NDSYITSMYIYESLVLVTWSNGIISLFNHKYNHIVSRKVTNHLIKNLCMNCSENMIAFMD
NMDSLYFINLNNNIINKGLHKNVIFISNDIYEKGYNYNNIDYNNDREIDRLSVDFTYNKL
NKKKKKMYDMNNKKDNIINVIISDEIMKYNIKNLTTFCINPYYNNNNNNNNNICVLTNKK
TVSLIYIYEYHINSVLLFKDDNILNIYWYESFIFICTPLSVFVINFFNKTKIAQMKFIGN
LNGNVDKTFFLFIENYTGKEKEFQGYNKINYIKRKEKKMEKKMERQKEDQTDNQKDGQKD
GQTDGQTDGQTNNQKDNTKNQLIHCSQNNYPCTYENLLYVIKTMWPNLFSVHICRGIEKG
VYIIAKEKNIKIIKIQKINGIEKVYILKDFYIENYILSINILYNTTYNILKNDFCLSVIA
FNMDTYISNVFTNYKDIKKNKFLEHYILTLNNFFLHKTKMTIFETQEKQNEENDKMKLEG
ENINIQNNSNDYNIHELYNNNHMIYKTIPQNEDHNVNINNNCADDIIQSQKQKITNISYN
NNNNNNQVQPNKYNHANQTTTKEQDNFFHFYKSNIYDMENRTCNNNILQYCVMNNKSYLF
HNISSKKNIYIKKKNHQFSLFIYSSINNTFIEFRPKTIEEIFYEFMLERKNTNIIYKKNI
MIKKKKCSTYKKNRLSIILKELRKDKKNRKELTNIVFKLIVHFCKNKKYYIAAKIFIMMY
TYLDNKEKVIYDIIKMFFLHNKLYIISLYYTKLKYALQNKQHGCFKKRKKIKKNKHAIYN
INRTIFLTTNDLSMKDQKERYYNTIRVSKKLNIKINFKLKIEKNVNKLVYIKHNNNIINP
QIKYITLIKMKKKNKIKSMLYIIFCLIKYYHNIKNFIAQEKNENNNKNDKMSNNNNNNNH
NNNHNNNNNHNNNHNNNNNHNNNHNNNHNNYHNNYHNNNHKIIRPFRVQEENNLSIYIKK
KKKERHKLKKKEVVVEKNNEKKKKKIEMYEENNKNYYNKDIKKNQKNEKKNFFFLTKNLF
NKFLVFLLYSNVYEFKKIFESSSSEDLNIYMLSKHIIYLLKDNFIFINNRLRNYYNLYRY
TLYYRYKTKKTYNNNYFLYKQKKINKKFKNFKINNSNTNTNNNRNIKYNNKNYCYCNLIS
YCENIKKNHNNLKNINKKYYHNNNQQTSHSFSPSPLHSTIYSPLLCCFCSSPFFSSSAED
YPIRITSSNAEKKILLDILLYIFFHFDIINFKDINCFFKDCLKNDSELLSVNKKILNFKE
KYKLITSIGKKIPVNDITNIQNKQDYHINNNNHTNCNSEIIDPKKFYTIQKNEQEEYIHP
KVPKNNHIYHINNLCDNYKKNNSLSLGYHKKDDNNNNIYAKYCFVNMSNSTYDIKQKKKE
HLIKEKDEKIFNKNCKKYQKNVQDENGPKCNNNIRKIEKKKIDKYNFNNTYIIQESKNDL
LYNNNNNNNNNNNHHHHINTTNDKYFYNLNKHPYDYSHFSKDTSFTTLDYFENQCDNMKK
LEIIKMLLNIKSEKVFLYLKQCNCNVVKEIIHKHVIKLCKLNLKKTVKLLLIINIKEKKN
EEYLFYPHIIINKLKKKPYYLYHYLKNIKDEYYISKYINVIIFLMFIFDPLYLEKFINKY
YKYIYFKKILFFISFFNYLYTNEQNIFSFQKKHEHISNNNSLDKTIESDDKNGKIGILLT
NIENTNLHNVECVDQNEQQKDEKNICNNNNNDCNNNNDCNNNNDCNNSCIDKHISVNVVE
QEKKNHILSYIYCKNNFMMNKKEKLFVNSNTKKSMFYFKNKYVSLIYKHLLNDRDNEEDK
KELFRIFNIVQNNSRTNMNKSMEFFLHIKALVYLKFGYINRALQIFLKLNNYLKIFYIMI
HHNVKIYDERIKRRMKYYIGSSDYFNNSIKKDKYGVCKISDSKNKTFNNNIINIVDIVNV
DNVDNDDDNNNNIYNTYNNYNNSYYHNYHDVRNKLNNSDKTILIEKYYEDNKNDFFKNNM
NYDDILYNRREANNYYDDTLIFKNKINEHKKFVVNKKYKIIKCIDNTYTFKVNKYLSKKK
IYKKLFMLYHKIVIYKHIMDLKNKNNKIFNTNDDISFNNINDTLEKKENKSCNSIDYIIE
KGIHNNSEYSFYDQQIMLDLYNHQQYMINNIKQEKNKKIKNYNHIISEIKREKHINSNLL
CKKNRKYTHKKKYNMLYLNNNKFIKNKIHKYNSDTNVLQNYLNNNINHHMNYFTLTYLLE
QCFYKNDLCENYNNILLNNKKSIFNFLNNMKKKGYTIYNGHMKKDIKKNEVNLLDINDFY
FLNNTNNKTQINKKNSDDSFYFDEYNNNKQTQQNHKHKYHIQKRKISSNVYLYEDINNNQ
YISNISSFCSLCLNNVYINPNTNKDEANKKNTLVFFFCNHLYHLKCLHNGEFLCKSCES
Download sequence
Identical sequences C0H539
5833.PFI0805w-1 XP_002808935.1.26446 gi|225631821|emb|CAX64216.1| gi|296005207|ref|XP_002808935.1| PFI0805w

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]