SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFI1250w from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFI1250w
Domain Number 1 Region: 21-125
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.63e-26
Family Thioltransferase 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PFI1250w
Sequence length 128
Comment Tlp2 thioredoxin-like protein 2 10563152:10564012 forward MW:14778
Sequence
MFFLQNLKKITHPKYLCTTIRRNVYTELNKIDDYLSKVNGNKLVVAQFGASWCAPCKKMK
PVIEKLGEDNDNIESLYIDIDEFPELGENEDINELPTILLRKNGKYLDKIIGMNESDLIK
AVEKHQSD
Download sequence
Identical sequences A0A024X8S4 A0A060RXI6 A0A2I0BSV2 C0H561 W4IIG0 W4J0S4
XP_002808957.1.26446 PFI1250w gi|225631843|emb|CAX64238.1| gi|296005251|ref|XP_002808957.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]