SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFI1320c from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PFI1320c
Domain Number - Region: 125-180
Classification Level Classification E-value
Superfamily RING/U-box 0.00332
Family RING finger domain, C3HC4 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PFI1320c
Sequence length 225
Comment PFI1320c conserved Plasmodium protein, unknown function 10634983:10635899 reverse MW:26099
Sequence
MGGDGGSLPQRVDLVRMKNKKLRENTGSLGYEKNTLVNVNQNKYNKKELREYHFNRCVIS
EELLKEPFFCCRLGYLYNKEHAFQLLLVKKQNKKKRKKDTFEKFAHVDSLKDLVLCKNKL
NEEGKLICLISKEIINSTSGGICLFSCGCVFSKKVFNRVNISEDKMCITCNKQYKESDII
EIGVEDVALLEEKQKSIIKKRKLEKKKKDSFLQAKKEMKNNDAVK
Download sequence
Identical sequences A0A024V943 A0A024WSD3 A0A024X7T9 A0A0L1IB57 A0A0L7KH71 A0A0L7M1L3 Q8I2P0 W4IHA7 W4J0T9 W7FDU6 W7FZQ0 W7JZ65
5833.PFI1320c-1 XP_001352139.1.26446 PFDG_02550T0 PFI1320c gi|124507085|ref|XP_001352139.1| gi|23505169|emb|CAD51950.1| PFHG_04420T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]