SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFL0595c from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFL0595c
Domain Number 1 Region: 43-204
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.17e-50
Family Glutathione peroxidase-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PFL0595c
Sequence length 205
Comment PFL0595c glutathione peroxidase 15340290:15341293 reverse MW:23952
Sequence
MFFSMFIKFILPISFICYNFGKKFNMFSYFQKIKVSEQELLSSIYDYEVKDLSGSNVSMS
KFKNKVLIIFNSASKCGLTKNHVEQFNKLHEKYNARGLEILAFPTSQFLNQEFDNTKDIC
TFNEKNKIKYNMFSPIEVNGDNTHPLFKYLKKNCDSMHDENGTLKSIGWNFGKFLVDKNG
EVVNYFSPKTNPLDLEKIIIQLLQK
Download sequence
Identical sequences A0A024VNQ3 A0A024WNL5 A0A024X5R4 A0A2I0BYP3 Q27742 Q8I5T2 W4IDL5 W7F4V6 W7JKN3
XP_001350528.1.26446 PFL0595c gi|124805752|ref|XP_001350528.1| gi|23496652|gb|AAN36208.1| 5833.PFL0595c-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]