SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PFL1640c from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PFL1640c
Domain Number - Region: 248-333
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000387
Family PDI-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PFL1640c
Sequence length 421
Comment PFL1640c conserved Plasmodium protein, unknown function 16216979:16218476 reverse MW:50656
Sequence
MLSLYKRIHTLSIILKNICKSENHLLHSSYMTINRIEKRAYTNNVKRRTDDYILNILENN
GVVLNKIGNFIVVKEDMNLLYERIIFNPVNYERVIEFIQMLDKNNLRQDFDIYYYEDSLR
NIKLNRDQNKKEIFINIKEILEKGKKIKNDEKKNYLEKQNIQSLYYYNIQRYQHNKDPSS
FLIDRRRLTKEEYIYQFISSILPYICFSFMLFFPHILICLYIPYIKKKNEKQKELCKILQ
LKQNIHSFKDIKPENILQIIDNNVKTVVFFYNHNIFLNMYIKSLMIDLSKIFKYNSIPVN
IVGIDVSKYNIQSNVLKDFNHNLFPLLYFILPYHYENDSAVLKIEEPLTTENILLQLRDF
VHIPKGTFDQIKDLNTISSKLKKCIFEHDIMNKNKGDILYDYGCEVAYLSCLKNNNKLSF
Y
Download sequence
Identical sequences Q8I582 W7JRF9
XP_001350734.1.26446 PFL1640c 5833.PFL1640c-1 gi|124806480|ref|XP_001350734.1| gi|23496861|gb|AAN36414.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]