SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MAL13P1.100 from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MAL13P1.100
Domain Number 1 Region: 18-153
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000183
Family Thioltransferase 0.02
Further Details:      
 
Weak hits

Sequence:  MAL13P1.100
Domain Number - Region: 149-229
Classification Level Classification E-value
Superfamily Cag-Z 0.0745
Family Cag-Z 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MAL13P1.100
Sequence length 533
Comment MAL13P1.100 conserved Plasmodium protein, unknown function 17845112:17846713 forward MW:63616
Sequence
MEYLLNNTLKKCDNKLSFFLGSKYKFSSLFENSKKNFNPLRFEMKEIDDYNYRNLLKNEK
AFLVYGYANYSYKCINIFNKLIDIVKEDFENKADRNVSIYKLNVSNNNLLVKQFHIKNIP
LIQLRYNNKLMQEINGNELNENNIKNILKRYYNYFNTLDCVNDINDFLVREKELSYNNNE
SFFESSKSYNNLKDESDNAYNELTFINDEKKQIITNEIKNHFKNNILDKLHLNYNCSSYI
VFKKLELLLMEKSNNIKLIKQFLNDIIFHHSTYLDINQHYSKITAKAFLHLFDEHSISIE
KLIELKNIILQNENQTDIKVDDIKLINFLEPIINFDNSKIIHYNKFQCINDFLSTSEETN
DHINLFLSSSIKKNILNTQLIDINQMNDHVKIKYLSRIYRILSIKYFHIGDIQNCLSCAL
HSYKLNAPLNNIDSNKSKVLIENLILYYGAYNKDIIHFLSELQFLFTDKNFKVIKLPHTR
AFKGGRPMMKRGKSGKWLWLSPDWKPRWLKKKSKLILEEEWKCVPDKNVPFWN
Download sequence
Identical sequences A0A024V338 A0A024VM77 A0A024W2Y8 A0A024WL09 A0A0L1I727 C0H5C4 W4IC30 W7F3F3 W7FQA9 W7JJ30 W7KBT4
gi|225631962|emb|CAX64302.1| gi|296005395|ref|XP_002809021.1| MAL13P1.100 XP_002809021.1.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]