SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MAL7P1.88 from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MAL7P1.88
Domain Number 1 Region: 214-332
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000706
Family Thioltransferase 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MAL7P1.88
Sequence length 449
Comment MAL7P1.88 thioredoxin-like protein 7444716:7447029 reverse MW:53378
Sequence
MNKINKLSKGNNIIFLNSKRCFYNFDGIYSKLEKCVMIKYPHKKRQPFEGNTLYNKYITT
NTNTNTNTNNKNGNNKSSNKKLYLCSLLSIGLVGYIYFNWYEKKKKVTGFLKEMKEISDE
LFDNLDNIVLFVLDKNKLNEEKKKIEHIKNEIQKLNIKNLNYLYTYNEHTKDYSCFLYKG
RRRRNITEDELVNEPIKDIVQPFFTPVSENYEQINQGNNTDKYPIYVTHDTFEKEIIEDS
KNNKILVVLFEDTCFLCFLYKPFINTLHKLFKENNIKLKIKKYNIEKNDYAPNMIVSRGT
PTFLLYHNGKGNKLAEYKPNDIINKIDEIIESPKNMKEQMLEKVELIHERMHLFGYLTMW
MTESKMIENMLIKRHIKDLSPKKSDDENIYNDILTSLIEEDIHRNDLIEESLDYSKEKIK
EAEKGCFVAAMMMANELIDEEKKKFSDIK
Download sequence
Identical sequences A0A2I0BP06 Q8IBS1
5833.MAL7P1.88-1 MAL7P1.88 gi|124511898|ref|XP_001349082.1| gi|23498850|emb|CAD50927.1| XP_001349082.1.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]