SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MAL8P1.17 from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MAL8P1.17
Domain Number 1 Region: 28-138
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.37e-34
Family PDI-like 0.0017
Further Details:      
 
Domain Number 2 Region: 317-463
Classification Level Classification E-value
Superfamily Thioredoxin-like 6e-30
Family PDI-like 0.001
Further Details:      
 
Domain Number 3 Region: 225-352
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.62e-17
Family PDI-like 0.0021
Further Details:      
 
Weak hits

Sequence:  MAL8P1.17
Domain Number - Region: 139-237
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00488
Family PDI-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MAL8P1.17
Sequence length 483
Comment PDI8 protein disulfide isomerase 9325966:9327572 reverse MW:55514
Sequence
MNRKYFSSLFLFLISFVFESFVRSHGDLFNHFVTDIHDGELDKFITKNDIVLVMFYAPWC
GHCKRLIPEYNEAANMLNEKKSEIKLVSIDATSENALAQEYGITGYPTLILFNKKNKINY
GGGRTAQSIVDWLLQMTGPVFSHVEGNIEDVLKEKKINVAFYLEYTSEDNDLYKKFNEVG
DKNREIAKYFVKKNDKHNKLFCFRTDEKKVEYDEKTPLEEFVTSESFPLFGEINTENYRF
YAESPKELVWVCATYEQYNEIKEHVRLAAQELRKKTHFVLLNIPEYAEHAKASLGLTEFP
GLAFQSNEGRYLLKNPKESLLNHNAIINFFKDVEAGKIEKSLKSEPIPEDDKNAPVKIVV
GNSFVDVVLKSGKDVLIEIYAPWCGHCKKLEPVYEDLGRKLKKYDSIIVAKMDGTLNETP
IKDFEWSGFPTIFFVKAGSKIPLPYEGERSLKGFVDFLNKHATNTPISIDGVPEFEDGTS
EEL
Download sequence
Identical sequences A0A024WR84 C0H4Y6 W7K5Y5
XP_002808883.1.26446 MAL8P1.17 gi|225632282|emb|CAX64161.1| gi|296005096|ref|XP_002808883.1| 5833.MAL8P1.17-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]