SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PF07_0036 from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PF07_0036
Domain Number 1 Region: 174-271
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.23e-26
Family Thioltransferase 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PF07_0036
Sequence length 272
Comment PF07_0036 Cg6 protein 7084110:7084928 reverse MW:32052
Sequence
MNKYIRAPNLIYICASLGIHSILFKKQKSPDNKNSYHIKDFIKLKNIIFLTSCEVTQDPK
EGGGKKNYDRYHNELFNNKINQNKVHIDNNELVNYFDELYEQSKNENIITKGEGEEVEFN
SSNLLLPFVEEHEHVKDKNDNDKCIKYEYVNDKCIKDEHGEFERVEENIKLSEDIINIIE
NILKKYNVVLFMKGTALNPYCKYSKQAIHILKLNKVKQIHTVNILDNQELRNALKIYSNW
PTFPQLYVNQKFIGGIDKLQELHDQNKIKDII
Download sequence
Identical sequences Q8IBZ7 W7K7N9
PF07_0036 XP_001349006.1.26446 gi|124511746|ref|XP_001349006.1| gi|23498774|emb|CAD50844.1| 5833.PF07_0036-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]