SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PF08_0032 from Plasmodium falciparum 3D7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PF08_0032
Domain Number 1 Region: 109-175
Classification Level Classification E-value
Superfamily Chaperone J-domain 4.84e-21
Family Chaperone J-domain 0.00056
Further Details:      
 
Domain Number 2 Region: 183-305
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000112
Family PDI-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PF08_0032
Sequence length 655
Comment PF08_0032 DnaJ protein, putative 9162991:9164958 forward MW:76682
Sequence
MGRKASNDSYENSDVNGAVSKRKSKGKDDINDIMNDLNKKKMNEKKNMKDKKDGNFSGNM
IGGMYKNKLRYILDNIIIISIILSFVVLISFKYLEEKYSIESYFEDGDSFDYYEVLKCKR
GDSIQKIKKNYRDLSKQYHPDSNKNCKDCDKKFQEITKAYKTLSDSRLKKAYDNSKGKVL
KLIESNSINLNMKNYVDLVENSNDYWIIQIYSDTDSLCLSFSNIWEESFDKYHEYISFGR
INISTDKKLIKQKVPFNVKIYPTIFILSPDGTYQLYSNIFNATSKDFQNFITSNYPNNIY
DLKMLNDALYKMSSLNVKKSGYIDKNHHVILLTNKKKLSLQAKQITYKFNNIYKTYSIKY
NEIDNISNESIKKSIIDSLKVLSIKKDEYLKENQNIDYFILVNNNQVKIIRRISPTNIKN
VYNDALKKNIVEINSINVDSVCSTMGSRKTYCYVIFVDNVDDEKNVNYMRKTYQNINSSY
NKFVSKNGSEETEEQLFIQPVYVLKKNLTKKFNKFINDKTINKYDSFLLDYSSNTFSSIN
EIKNLSNYSQNKDDLSFLHNIYKDIEILNFQKIPKYCLPFNINCLFNIKTTTPYKLYNII
NRTSKLQIIFSLIVGFMLFPTFKEYGFLKYVLFALSVGFSVIVINIKDFILLLAS
Download sequence
Identical sequences A0A024WSA3 Q8IB72 W7JVI6
XP_001349286.1.26446 gi|124512306|ref|XP_001349286.1| gi|23499055|emb|CAD51135.1| 5833.PF08_0032-1 PF08_0032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]